SCOPe 2.08: Domain d4jz3a1: 4jz3 A:85-140

Lineage for d4jz3a1 (4jz3 A:85-140)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein c-src protein tyrosine kinase [50064] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [50066] (28 PDB entries)

8. Domain d4jz3a1: 4jz3 A:85-140 [256825]
   Other proteins in same PDB: d4jz3a2
   automated match to d1e6ga_
   complexed with peg, pge
   fragment; missing more than one-third of the common structure and/or sequence

Details for d4jz3a1

PDB Entry: 4jz3, 1.85 Å

PDB Description: crystal structure of the chicken c-src-sh3 domain intertwined dimer

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d4jz3a1:

Sequence; same for both SEQRES and ATOM records:

>d4jz3a1 b.34.2.1 (A:85-140) c-src protein tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps

Timeline for d4jz3a1:

• d4jz3a1 first appeared in SCOPe 2.04, called d4jz3a_
  
• d4jz3a1 appears in SCOPe 2.07