Lineage for d4jz3a1 (4jz3 A:85-140)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2782953Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 2782957Species Chicken (Gallus gallus) [TaxId:9031] [50066] (28 PDB entries)
  8. 2782965Domain d4jz3a1: 4jz3 A:85-140 [256825]
    Other proteins in same PDB: d4jz3a2
    automated match to d1e6ga_
    complexed with peg, pge

    fragment; missing more than one-third of the common structure and/or sequence

Details for d4jz3a1

PDB Entry: 4jz3 (more details), 1.85 Å

PDB Description: crystal structure of the chicken c-src-sh3 domain intertwined dimer
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d4jz3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jz3a1 b.34.2.1 (A:85-140) c-src protein tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps

SCOPe Domain Coordinates for d4jz3a1:

Click to download the PDB-style file with coordinates for d4jz3a1.
(The format of our PDB-style files is described here.)

Timeline for d4jz3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jz3a2