Lineage for d1efua1 (1efu A:205-296)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60076Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 60087Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 60088Family b.43.3.1: Elongation factors [50448] (4 proteins)
  6. 60102Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
  7. 60108Species Escherichia coli [TaxId:562] [50450] (4 PDB entries)
  8. 60115Domain d1efua1: 1efu A:205-296 [25682]
    Other proteins in same PDB: d1efua2, d1efua3, d1efub2, d1efub3, d1efub4, d1efuc2, d1efuc3, d1efud2, d1efud3, d1efud4

Details for d1efua1

PDB Entry: 1efu (more details), 2.5 Å

PDB Description: elongation factor complex ef-tu/ef-ts from escherichia coli

SCOP Domain Sequences for d1efua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efua1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOP Domain Coordinates for d1efua1:

Click to download the PDB-style file with coordinates for d1efua1.
(The format of our PDB-style files is described here.)

Timeline for d1efua1: