![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
![]() | Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) ![]() |
![]() | Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
![]() | Protein automated matches [195197] (4 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:208964] [226711] (3 PDB entries) |
![]() | Domain d4juqa_: 4juq A: [256813] automated match to d4fo8c_ complexed with mn; mutant |
PDB Entry: 4juq (more details), 2.2 Å
SCOPe Domain Sequences for d4juqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4juqa_ d.127.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} nvtiktpddiekmriagrlaaevlemigehikpgvtteeldrichdyivneqkaipapln ykgfpksictsinhvvchgipnekplkegdilnvditvikdgyhgdtskmflvgktpewa drlcqitqecmykgisvvrpgahlgdigeiiqkhaekngfsvvreycghgigkvfheepq vlhygragtgielkegmiftiepminqgrpetrllgdgwtaitkdrklsaqwehtvlvta dgyeiltlrndetfprts
Timeline for d4juqa_: