Lineage for d4juqa_ (4juq A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974562Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2974563Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2974564Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2974703Protein automated matches [195197] (6 species)
    not a true protein
  7. 2974716Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [226711] (3 PDB entries)
  8. 2974725Domain d4juqa_: 4juq A: [256813]
    automated match to d4fo8c_
    complexed with mn; mutant

Details for d4juqa_

PDB Entry: 4juq (more details), 2.2 Å

PDB Description: Pseudomonas aeruginosa MetAP T2N mutant, in Mn form
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d4juqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4juqa_ d.127.1.1 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
nvtiktpddiekmriagrlaaevlemigehikpgvtteeldrichdyivneqkaipapln
ykgfpksictsinhvvchgipnekplkegdilnvditvikdgyhgdtskmflvgktpewa
drlcqitqecmykgisvvrpgahlgdigeiiqkhaekngfsvvreycghgigkvfheepq
vlhygragtgielkegmiftiepminqgrpetrllgdgwtaitkdrklsaqwehtvlvta
dgyeiltlrndetfprts

SCOPe Domain Coordinates for d4juqa_:

Click to download the PDB-style file with coordinates for d4juqa_.
(The format of our PDB-style files is described here.)

Timeline for d4juqa_: