SCOPe 2.04: Domain d4juna_: 4jun A:

Lineage for d4juna_ (4jun A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (23 species)
   not a true protein

7. Species Influenza a virus [TaxId:365085] [256811] (1 PDB entry)

8. Domain d4juna_: 4jun A: [256812]
   Other proteins in same PDB: d4junb_
   automated match to d4bh4a_
   complexed with epe, nag

Details for d4juna_

PDB Entry: 4jun, 2.34 Å

PDB Description: crystal structure of h5n1 influenza virus hemagglutinin, clade 5

PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d4juna_:

Sequence; same for both SEQRES and ATOM records:

>d4juna_ b.19.1.2 (A:) automated matches {Influenza a virus [TaxId: 365085]}
gdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvag
wllgnpicdefinvpewsyivekaspandlcypgdfndyeelkhllsrinhfekiqiipk
sswsnheassgvssacpyqgrpsffrnvvwlikknsayptikrsynntsqedllvlwgih
hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndai
nfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplti
gecpkyvkssrlvlatglrns

Timeline for d4juna_:

• d4juna_ is new in SCOPe 2.04-stable
  
• d4juna_ appears in SCOPe 2.05
  
• d4juna_ appears in the current release, SCOPe 2.08, called d4juna1