Lineage for d4junb_ (4jun B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2267375Protein automated matches [254646] (34 species)
    not a true protein
  7. 2267593Species Influenza a virus [TaxId:365085] [256809] (1 PDB entry)
  8. 2267594Domain d4junb_: 4jun B: [256810]
    Other proteins in same PDB: d4juna1, d4juna2, d4junc1, d4junc2, d4june1, d4june2
    automated match to d4n5zb_
    complexed with epe, nag

Details for d4junb_

PDB Entry: 4jun (more details), 2.34 Å

PDB Description: crystal structure of h5n1 influenza virus hemagglutinin, clade 5
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d4junb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4junb_ h.3.1.1 (B:) automated matches {Influenza a virus [TaxId: 365085]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
rvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkr

SCOPe Domain Coordinates for d4junb_:

Click to download the PDB-style file with coordinates for d4junb_.
(The format of our PDB-style files is described here.)

Timeline for d4junb_: