Lineage for d4juma1 (4jum A:11-323)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2040385Domain d4juma1: 4jum A:11-323 [256808]
    Other proteins in same PDB: d4juma2, d4jumb_
    automated match to d4bh4a_
    complexed with nag

Details for d4juma1

PDB Entry: 4jum (more details), 2 Å

PDB Description: Crystal structure of H5N1 influenza virus hemagglutinin, clade 4
PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d4juma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4juma1 b.19.1.2 (A:11-323) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannstvqvdtimeknvtvthaqdilekthngklcsldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrinhfekiqiipks
swpnheaslgvssacpylgessffrnvvwlikknssyptikrsynntnqedllvlwgihh
pndaaeqiklyqnpntyisvgtstlnqrlvptiatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnt

SCOPe Domain Coordinates for d4juma1:

Click to download the PDB-style file with coordinates for d4juma1.
(The format of our PDB-style files is described here.)

Timeline for d4juma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4juma2
View in 3D
Domains from other chains:
(mouse over for more information)
d4jumb_