| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein automated matches [254646] (29 species) not a true protein |
| Species Influenza A virus [TaxId:573943] [256802] (1 PDB entry) |
| Domain d4jukb_: 4juk B: [256803] Other proteins in same PDB: d4juka_ automated match to d4n5zb_ complexed with nag, so4 |
PDB Entry: 4juk (more details), 2.75 Å
SCOPe Domain Sequences for d4jukb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jukb_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 573943]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkr
Timeline for d4jukb_: