Lineage for d4jpze_ (4jpz E:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543031Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1543032Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 1543307Protein automated matches [190637] (2 species)
    not a true protein
  7. 1543308Species Human (Homo sapiens) [TaxId:9606] [187699] (6 PDB entries)
  8. 1543315Domain d4jpze_: 4jpz E: [256798]
    Other proteins in same PDB: d4jpzc_
    automated match to d3hbwa_
    complexed with ca

Details for d4jpze_

PDB Entry: 4jpz (more details), 3.02 Å

PDB Description: voltage-gated sodium channel 1.2 c-terminal domain in complex with fgf13u and ca2+/calmodulin
PDB Compounds: (E:) Fibroblast growth factor 13

SCOPe Domain Sequences for d4jpze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jpze_ b.42.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqlkgivtklysrqgyhlqlqadgtidgtkdedstytlfnlipvglrvvaiqgvqtklyl
amnsegylytselftpeckfkesvfenyyvtyssmiyrqqqsgrgwylglnkegeimkgn
hvkknkpaahflpkplkvamykepslhd

SCOPe Domain Coordinates for d4jpze_:

Click to download the PDB-style file with coordinates for d4jpze_.
(The format of our PDB-style files is described here.)

Timeline for d4jpze_: