![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.1: Cytokine [50353] (3 families) ![]() |
![]() | Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) |
![]() | Protein automated matches [190637] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187699] (7 PDB entries) |
![]() | Domain d4jpza_: 4jpz A: [256797] Other proteins in same PDB: d4jpzc_, d4jpzi_ automated match to d3hbwa_ complexed with ca |
PDB Entry: 4jpz (more details), 3.02 Å
SCOPe Domain Sequences for d4jpza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jpza_ b.42.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pqlkgivtklysrqgyhlqlqadgtidgtkdedstytlfnlipvglrvvaiqgvqtklyl amnsegylytselftpeckfkesvfenyyvtyssmiyrqqqsgrgwylglnkegeimkgn hvkknkpaahflpkplkvamykepslhd
Timeline for d4jpza_: