SCOPe 2.05: Domain d4jkxa_: 4jkx A:

Lineage for d4jkxa_ (4jkx A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (8 species)
   not a true protein

7. Species European mistletoe (Viscum album) [TaxId:3972] [188629] (6 PDB entries)

8. Domain d4jkxa_: 4jkx A: [256796]
   Other proteins in same PDB: d4jkxb1, d4jkxb2
   automated match to d1puma_
   complexed with azi, cl, dio, edo, gol, h35, nag, so4

Details for d4jkxa_

PDB Entry: 4jkx, 2.35 Å

PDB Description: crystal structure mistletoe lectin i from viscum album in complex with kinetin at 2.35 a resolution.

PDB Compounds: (A:) Beta-galactoside-specific lectin 1 A chain

SCOPe Domain Sequences for d4jkxa_:

Sequence; same for both SEQRES and ATOM records:

>d4jkxa_ d.165.1.1 (A:) automated matches {European mistletoe (Viscum album) [TaxId: 3972]}
yerlrlrvthqttgaeyfsfitllrdyvssgsfsnqipllrqstipvsegqrfvlveltn
aggdsitaaidvtnlyvvayqagdqsyflkdapagaetqdftgttrsslpfngsypdler
yaghrdqiplgidqliqsvtalrfpggstrtqarsililiqmiseaarfnpilwrarqyi
nsgasflpdvymleletswgqqstqvqhstdgvfnnpirlalapanivtltnvrdviasl
aimlfvcge

Timeline for d4jkxa_:

• d4jkxa_ first appeared in SCOPe 2.04
  
• d4jkxa_ appears in SCOPe 2.06
  
• d4jkxa_ appears in the current release, SCOPe 2.08