SCOPe 2.07: Domain d4jkxb2: 4jkx B:138-263

Lineage for d4jkxb2 (4jkx B:138-263)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein automated matches [190608] (4 species)
   not a true protein

7. Species European mistletoe (Viscum album) [TaxId:3972] [225471] (7 PDB entries)

8. Domain d4jkxb2: 4jkx B:138-263 [256795]
   Other proteins in same PDB: d4jkxa_
   automated match to d1sz6b2
   complexed with azi, cl, dio, edo, gol, h35, nag, so4

Details for d4jkxb2

PDB Entry: 4jkx, 2.35 Å

PDB Description: crystal structure mistletoe lectin i from viscum album in complex with kinetin at 2.35 a resolution.

PDB Compounds: (B:) Beta-galactoside-specific lectin 1 B chain

SCOPe Domain Sequences for d4jkxb2:

Sequence; same for both SEQRES and ATOM records:

>d4jkxb2 b.42.2.1 (B:138-263) automated matches {European mistletoe (Viscum album) [TaxId: 3972]}
taprevtiygfrdlcmesnggsvwvetcvasqqnqrwalygdgsirpkqnqsqcltcgrd
svstvinivscsagssgqrwvftnagailnlknglamdvaqanpslqriiiypatgnpnq
mwlpvp

Timeline for d4jkxb2:

• d4jkxb2 first appeared in SCOPe 2.04
  
• d4jkxb2 appears in SCOPe 2.06
  
• d4jkxb2 appears in the current release, SCOPe 2.08