Class b: All beta proteins [48724] (178 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) |
Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
Protein automated matches [190608] (4 species) not a true protein |
Species European mistletoe (Viscum album) [TaxId:3972] [225471] (7 PDB entries) |
Domain d4jkxb2: 4jkx B:138-263 [256795] Other proteins in same PDB: d4jkxa_ automated match to d1sz6b2 complexed with azi, cl, dio, edo, gol, h35, nag, so4 |
PDB Entry: 4jkx (more details), 2.35 Å
SCOPe Domain Sequences for d4jkxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jkxb2 b.42.2.1 (B:138-263) automated matches {European mistletoe (Viscum album) [TaxId: 3972]} taprevtiygfrdlcmesnggsvwvetcvasqqnqrwalygdgsirpkqnqsqcltcgrd svstvinivscsagssgqrwvftnagailnlknglamdvaqanpslqriiiypatgnpnq mwlpvp
Timeline for d4jkxb2: