![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
![]() | Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) ![]() |
![]() | Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins) |
![]() | Protein automated matches [190834] (3 species) not a true protein |
![]() | Species Streptomyces aureofaciens [TaxId:1894] [188142] (10 PDB entries) |
![]() | Domain d4j5ka_: 4j5k A: [256790] automated match to d1lnia_ complexed with gol, so4; mutant |
PDB Entry: 4j5k (more details), 1.23 Å
SCOPe Domain Sequences for d4j5ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j5ka_ d.1.1.2 (A:) automated matches {Streptomyces aureofaciens [TaxId: 1894]} dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygfyheytvitp gartrgtrriitgeatqedyytgdhyatfslidqtc
Timeline for d4j5ka_: