SCOPe 2.08: Domain d4j5ka_: 4j5k A:

Lineage for d4j5ka_ (4j5k A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein automated matches [190834] (3 species)
   not a true protein

7. Species Streptomyces aureofaciens [TaxId:1894] [188142] (10 PDB entries)

8. Domain d4j5ka_: 4j5k A: [256790]
   automated match to d1lnia_
   complexed with gol, so4; mutant

Details for d4j5ka_

PDB Entry: 4j5k, 1.23 Å

PDB Description: Crystal structure analysis of Streptomyces aureofaciens ribonuclease Sa Y51F mutant

PDB Compounds: (A:) guanyl-specific ribonuclease sa

SCOPe Domain Sequences for d4j5ka_:

Sequence; same for both SEQRES and ATOM records:

>d4j5ka_ d.1.1.2 (A:) automated matches {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygfyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

Timeline for d4j5ka_:

• d4j5ka_ first appeared in SCOPe 2.04
  
• d4j5ka_ appears in SCOPe 2.07