SCOPe 2.06: Domain d4igmb_: 4igm B:

Lineage for d4igmb_ (4igm B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189102] (6 PDB entries)

8. Domain d4igmb_: 4igm B: [256778]
   automated match to d2wm1a_
   complexed with zn

Details for d4igmb_

PDB Entry: 4igm, 2.39 Å

PDB Description: 2.39 angstrom x-ray crystal structure of human acmsd

PDB Compounds: (B:) 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase

SCOPe Domain Sequences for d4igmb_:

Sequence; same for both SEQRES and ATOM records:

>d4igmb_ c.1.9.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkidihshilpkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrencwdpevri
remdqkgvtvqalstvpvmfsywakpedtlnlcqllnndlastvvsyprrfvglgtlpmq
apelavkemercvkelgfpgvqigthvnewdlnaqelfpvyaaaerlkcslfvhpwdmqm
dgrmakywlpwlvgmpaettiaicsmimggvfekfpklkvcfahgggafpftvgrishgf
smrpdlcaqdnpmnpkkylgsfytdalvhdplslklltdvigkdkvilgtdypfplgele
pgkliesmeefdeetknklkagnalaflgler

Timeline for d4igmb_:

• d4igmb_ first appeared in SCOPe 2.04
  
• d4igmb_ appears in SCOPe 2.05
  
• d4igmb_ appears in SCOPe 2.07
  
• d4igmb_ appears in the current release, SCOPe 2.08