Class g: Small proteins [56992] (91 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.0: automated matches [227227] (1 protein) not a true family |
Protein automated matches [226968] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225423] (21 PDB entries) |
Domain d4d0fa2: 4d0f A:453-491 [256763] automated match to d1toza2 complexed with ca, edo; mutant |
PDB Entry: 4d0f (more details), 2.8 Å
SCOPe Domain Sequences for d4d0fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d0fa2 g.3.11.0 (A:453-491) automated matches {Human (Homo sapiens) [TaxId: 9606]} vnecvsnpcqndaacldqigefqcicmpgyegvhcevnt
Timeline for d4d0fa2: