SCOPe 2.04: Domain d4d00a_: 4d00 A:

Lineage for d4d00a_ (4d00 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (14 species)
   not a true protein

7. Species Influenza virus a/jiangxi- donghu/346/2013 (h10n8) [TaxId:11309] [256758] (1 PDB entry)

8. Domain d4d00a_: 4d00 A: [256759]
   Other proteins in same PDB: d4d00b_
   automated match to d1rd8a_
   complexed with nag, ni

Details for d4d00a_

PDB Entry: 4d00, 2.5 Å

PDB Description: haemagglutinin of h10n8 influenza virus isolated from humans in complex with human receptor analogue 6'sln

PDB Compounds: (A:) haemagglutinin ha1

SCOPe Domain Sequences for d4d00a_:

Sequence; same for both SEQRES and ATOM records:

>d4d00a_ b.19.1.0 (A:) automated matches {Influenza virus a/jiangxi- donghu/346/2013 (h10n8) [TaxId: 11309]}
pdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigm
ligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygs
sinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
stqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
kyvnrrslmlatgmrnvpe

Timeline for d4d00a_:

• d4d00a_ is new in SCOPe 2.04-stable
  
• d4d00a_ appears in SCOPe 2.05
  
• d4d00a_ appears in the current release, SCOPe 2.08