![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (49 species) not a true protein |
![]() | Species Caulobacter vibrioides [TaxId:155892] [256751] (9 PDB entries) |
![]() | Domain d4czea1: 4cze A:10-149 [256752] automated match to d1jcea1 complexed with po4 |
PDB Entry: 4cze (more details), 2 Å
SCOPe Domain Sequences for d4czea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4czea1 c.55.1.0 (A:10-149) automated matches {Caulobacter vibrioides [TaxId: 155892]} sndiaidlgtantliyqkgkgivlnepsvvalrnvggrkvvhavgieakqmlgrtpghme airpmrdgviadfevaeemikyfirkvhnrkgfvnpkvivcvpsgataverraindscln agarrvglidepmaaaigag
Timeline for d4czea1: