Lineage for d4cyza_ (4cyz A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778497Protein automated matches [190291] (24 species)
    not a true protein
  7. 1778533Species Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256747] (1 PDB entry)
  8. 1778534Domain d4cyza_: 4cyz A: [256748]
    Other proteins in same PDB: d4cyzb_, d4cyzd_, d4cyzf_
    automated match to d4dj6a_
    complexed with edo, nag

Details for d4cyza_

PDB Entry: 4cyz (more details), 2.4 Å

PDB Description: structure of the a_mallard_sweden_51_2002 h10 avian haemmaglutinin in complex with avian receptor analog lsta
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4cyza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cyza_ b.19.1.2 (A:) automated matches {Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]}
dkiclghhavangtivktltneqeevtnatetvestsldrlcmkgrshkdlgnchpigml
igtpacdlhltgtwdtlierenaiaycypgatvneealrqkimesggiskistgftygss
insagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss
tqekndlygtqslsisvgsstyqsnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh
nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
yvnkkslmlatgmrnvpe

SCOPe Domain Coordinates for d4cyza_:

Click to download the PDB-style file with coordinates for d4cyza_.
(The format of our PDB-style files is described here.)

Timeline for d4cyza_: