![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein automated matches [254646] (29 species) not a true protein |
![]() | Species Influenza A virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256742] (3 PDB entries) |
![]() | Domain d4cywb_: 4cyw B: [256746] Other proteins in same PDB: d4cywa_, d4cywc_, d4cywe_ automated match to d3m5ib_ complexed with nag |
PDB Entry: 4cyw (more details), 2.6 Å
SCOPe Domain Sequences for d4cywb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cywb_ h.3.1.1 (B:) automated matches {Influenza A virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]} glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
Timeline for d4cywb_: