Lineage for d4cyvb_ (4cyv B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1969985Species Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256742] (3 PDB entries)
  8. 1969986Domain d4cyvb_: 4cyv B: [256743]
    Other proteins in same PDB: d4cyva_, d4cyvc_, d4cyve_
    automated match to d4dj7d_
    complexed with edo, nag

Details for d4cyvb_

PDB Entry: 4cyv (more details), 2.3 Å

PDB Description: structure of the a_mallard_sweden_51_2002 h10 avian haemmaglutinin
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4cyvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cyvb_ h.3.1.1 (B:) automated matches {Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

SCOPe Domain Coordinates for d4cyvb_:

Click to download the PDB-style file with coordinates for d4cyvb_.
(The format of our PDB-style files is described here.)

Timeline for d4cyvb_: