Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Streptomyces coelicolor [TaxId:1902] [256735] (2 PDB entries) |
Domain d4cybb_: 4cyb B: [256739] automated match to d2vxxb_ complexed with fe, na |
PDB Entry: 4cyb (more details), 1.78 Å
SCOPe Domain Sequences for d4cybb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cybb_ a.25.1.0 (B:) automated matches {Streptomyces coelicolor [TaxId: 1902]} rtiqefgtvkqfpvaltmdtrlyscqrlnkvladtrilhdlykkyhwlmrgatfyqlhll ldkhageqlelidtvaervqtlggvavgdprhvaeittvprppdgveevpsmlsrlleah eliltechdaaartqeygddgtndllvsevlrtnelqawfvaehlvdtplvh
Timeline for d4cybb_: