![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (34 species) not a true protein |
![]() | Species Streptomyces coelicolor [TaxId:1902] [256737] (1 PDB entry) |
![]() | Domain d4cy9a1: 4cy9 A:4-170 [256738] Other proteins in same PDB: d4cy9a2 automated match to d1vele_ complexed with gol |
PDB Entry: 4cy9 (more details), 1.78 Å
SCOPe Domain Sequences for d4cy9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cy9a1 a.25.1.1 (A:4-170) automated matches {Streptomyces coelicolor [TaxId: 1902]} dltpkytvpgiereaagrligvlrlrlhalndlhltlkhvhwnvvgphfiavhemidpqv dqvrdmaddvaeriaalggvaqgtpgalvaerkwddysigradaiahlgaldvvytgvve gmraaveeagkidpatedlligqlrdleqfqwfvrahlesaggalat
Timeline for d4cy9a1: