Lineage for d4cy9a1 (4cy9 A:4-170)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2703201Species Streptomyces coelicolor [TaxId:1902] [256737] (1 PDB entry)
  8. 2703202Domain d4cy9a1: 4cy9 A:4-170 [256738]
    Other proteins in same PDB: d4cy9a2
    automated match to d1vele_
    complexed with gol

Details for d4cy9a1

PDB Entry: 4cy9 (more details), 1.78 Å

PDB Description: DpsA14 from Streptomyces coelicolor
PDB Compounds: (A:) dpsa

SCOPe Domain Sequences for d4cy9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cy9a1 a.25.1.1 (A:4-170) automated matches {Streptomyces coelicolor [TaxId: 1902]}
dltpkytvpgiereaagrligvlrlrlhalndlhltlkhvhwnvvgphfiavhemidpqv
dqvrdmaddvaeriaalggvaqgtpgalvaerkwddysigradaiahlgaldvvytgvve
gmraaveeagkidpatedlligqlrdleqfqwfvrahlesaggalat

SCOPe Domain Coordinates for d4cy9a1:

Click to download the PDB-style file with coordinates for d4cy9a1.
(The format of our PDB-style files is described here.)

Timeline for d4cy9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cy9a2