Lineage for d4cyaa_ (4cya A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2705142Species Streptomyces coelicolor [TaxId:1902] [256735] (2 PDB entries)
  8. 2705155Domain d4cyaa_: 4cya A: [256736]
    automated match to d1vele_

Details for d4cyaa_

PDB Entry: 4cya (more details), 1.86 Å

PDB Description: DpsA15 from Streptomyces coelicolor
PDB Compounds: (A:) dpsa15

SCOPe Domain Sequences for d4cyaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cyaa_ a.25.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
dltpkytvpgiereaagrligvlrlrlhalndlhltlkhvhwnvvgphfiavhemidpqv
dqvrdmaddvaeriaalggvaqgtpgalvaerkwddysigradaiahlgaldvvytgvve
gmraaveeagkidpatedlligqlrdleqfqwfvrahles

SCOPe Domain Coordinates for d4cyaa_:

Click to download the PDB-style file with coordinates for d4cyaa_.
(The format of our PDB-style files is described here.)

Timeline for d4cyaa_: