SCOPe 2.08: Domain d4cxad2: 4cxa D:158-262

Lineage for d4cxad2 (4cxa D:158-262)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries)

8. Domain d4cxad2: 4cxa D:158-262 [256731]
   Other proteins in same PDB: d4cxaa_, d4cxac_
   automated match to d2i53a2
   complexed with anp

Details for d4cxad2

PDB Entry: 4cxa, 3.15 Å

PDB Description: crystal structure of the human cdk12-cyclin k complex bound to amppnp

PDB Compounds: (D:) cyclin-k

SCOPe Domain Sequences for d4cxad2:

Sequence; same for both SEQRES and ATOM records:

>d4cxad2 a.74.1.1 (D:158-262) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqwepeiiavavmylagrl
ckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlysqgk

Timeline for d4cxad2:

• d4cxad2 first appeared in SCOPe 2.04
  
• d4cxad2 appears in SCOPe 2.07