Lineage for d1ddia1 (1ddi A:226-446)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
barrel, closed; n=6, S=10; greek-keySuperfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) 
Family b.43.4.1: NADPH-cytochrome p450 reductase FAD-binding domain-like [50438] (4 proteins)
there is an alpha-helical subdomain inserted in this domain
automatically mapped to Pfam PF00667
Protein Sulfite reductase flavoprotein [50441] (1 species) Species Escherichia coli [TaxId:562] [50442] (2 PDB entries) 
Domain d1ddia1: 1ddi A:226-446 [25673]
Other proteins in same PDB: d1ddia2
complexed with fad, nap
Details for d1ddia1
PDB Entry: 1ddi (more details), 2.51 Å
PDB Description: crystal structure of sir-fp60
PDB Compounds: (A:) sulfite reductase [nadph] flavoprotein alpha-componentSCOPe Domain Sequences for d1ddia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ddia1 b.43.4.1 (A:226-446) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]}
ihtspyskdaplvaslsvnqkitgrnsekdvrhieidlgdsglryqpgdalgvwyqndpa
lvkelvellwlkgdepvtvegktlplnealqwhfeltvntanivenyatltrsetllplv
gdkaklqhyaattpivdmvrfspaqldaealinllrpltprlysiassqaevenevhvtv
gvvrydvegraraggassfladrveeegevrvfiehndnfr
SCOPe Domain Coordinates for d1ddia1:
Click to download the PDB-style file with coordinates for d1ddia1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ddia1:
- d1ddia1 first appeared (with stable ids) in SCOP 1.55
- d1ddia1 appears in SCOPe 2.07
View in 3D
