| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein automated matches [227027] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries) |
| Domain d4cxab2: 4cxa B:158-265 [256729] Other proteins in same PDB: d4cxaa_, d4cxac_ automated match to d2i53a2 complexed with anp |
PDB Entry: 4cxa (more details), 3.15 Å
SCOPe Domain Sequences for d4cxab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cxab2 a.74.1.1 (B:158-265) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqwepeiiavavmylagrl
ckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlysqgkqqm
Timeline for d4cxab2:
View in 3DDomains from other chains: (mouse over for more information) d4cxaa_, d4cxac_, d4cxad1, d4cxad2 |