Lineage for d4cufa1 (4cuf A:412-452)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258773Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 2258774Protein automated matches [226968] (4 species)
    not a true protein
  7. 2258775Species Human (Homo sapiens) [TaxId:9606] [225423] (29 PDB entries)
  8. 2258817Domain d4cufa1: 4cuf A:412-452 [256720]
    Other proteins in same PDB: d4cufa4
    automated match to d1toza1
    complexed with ca, edo; mutant

Details for d4cufa1

PDB Entry: 4cuf (more details), 2.29 Å

PDB Description: human notch1 egf domains 11-13 mutant t466s
PDB Compounds: (A:) Neurogenic locus notch homolog protein 1

SCOPe Domain Sequences for d4cufa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cufa1 g.3.11.0 (A:412-452) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvdecslganpcehagkcintlgsfecqclqgytgprceid

SCOPe Domain Coordinates for d4cufa1:

Click to download the PDB-style file with coordinates for d4cufa1.
(The format of our PDB-style files is described here.)

Timeline for d4cufa1: