Class g: Small proteins [56992] (94 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.0: automated matches [227227] (1 protein) not a true family |
Protein automated matches [226968] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225423] (29 PDB entries) |
Domain d4cufa1: 4cuf A:412-452 [256720] Other proteins in same PDB: d4cufa4 automated match to d1toza1 complexed with ca, edo; mutant |
PDB Entry: 4cuf (more details), 2.29 Å
SCOPe Domain Sequences for d4cufa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cufa1 g.3.11.0 (A:412-452) automated matches {Human (Homo sapiens) [TaxId: 9606]} dvdecslganpcehagkcintlgsfecqclqgytgprceid
Timeline for d4cufa1: