Lineage for d4cuea2 (4cue A:453-491)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031827Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 3031828Protein automated matches [226968] (5 species)
    not a true protein
  7. 3031829Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries)
  8. 3031882Domain d4cuea2: 4cue A:453-491 [256718]
    Other proteins in same PDB: d4cuea4
    automated match to d1toza2
    complexed with ca; mutant

Details for d4cuea2

PDB Entry: 4cue (more details), 3 Å

PDB Description: human notch1 egf domains 11-13 mutant t466v
PDB Compounds: (A:) Neurogenic locus notch homolog protein 1

SCOPe Domain Sequences for d4cuea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cuea2 g.3.11.0 (A:453-491) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnecvsnpcqndavcldqigefqcicmpgyegvhcevnt

SCOPe Domain Coordinates for d4cuea2:

Click to download the PDB-style file with coordinates for d4cuea2.
(The format of our PDB-style files is described here.)

Timeline for d4cuea2: