Lineage for d4ct0a2 (4ct0 A:206-496)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003513Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 2003514Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) (S)
    automatically mapped to Pfam PF03441
  5. 2003515Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (3 protein domains)
  6. 2003546Protein automated matches [228408] (1 species)
    not a true protein
  7. 2003547Species Mouse (Mus musculus) [TaxId:10090] [228409] (5 PDB entries)
  8. 2003554Domain d4ct0a2: 4ct0 A:206-496 [256693]
    Other proteins in same PDB: d4ct0a1
    automated match to d4k0ra2
    complexed with cl, p6g, zn

Details for d4ct0a2

PDB Entry: 4ct0 (more details), 2.45 Å

PDB Description: Crystal Structure of Mouse Cryptochrome1 in Complex with Period2
PDB Compounds: (A:) Cryptochrome-1

SCOPe Domain Sequences for d4ct0a2:

Sequence, based on SEQRES records: (download)

>d4ct0a2 a.99.1.1 (A:206-496) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ssavwpggetealtrlerhlerkawvanferprmnansllasptglspylrfgclscrlf
yfkltdlykkvkknsspplslygqllwreffytaatnnprfdkmegnpicvqipwdknpe
alakwaegrtgfpwidaimtqlrqegwihhlarhavacfltrgdlwisweegmkvfeell
ldadwsinagswmwlscssffqqffhcycpvgfgrrtdpngdyirrylpvlrgfpakyiy
dpwnapegiqkvakcligvnypkpmvnhaeasrlniermkqiyqqlsryrg

Sequence, based on observed residues (ATOM records): (download)

>d4ct0a2 a.99.1.1 (A:206-496) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ssavwpggetealtrlerhlerkawvaansllasptglspylrfgclscrlfyfkltdly
kkvkknsspplslygqllwreffytaatnnprfdkmegnpicvqipwdknpealakwaeg
rtgfpwidaimtqlrqegwihhlarhavacfltrgdlwisweegmkvfeellldadwsin
agswmwlscssffqqffhcycpvgfgrrtdpngdyirrylpvlrgfpakyiydpwnapeg
iqkvakcligvnypkpmvnhaeasrlniermkqiyqqlsryrg

SCOPe Domain Coordinates for d4ct0a2:

Click to download the PDB-style file with coordinates for d4ct0a2.
(The format of our PDB-style files is described here.)

Timeline for d4ct0a2: