Lineage for d4ct0a1 (4ct0 A:3-205)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861787Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2861788Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) (S)
    automatically mapped to Pfam PF00875
  5. 2861789Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (3 proteins)
  6. 2861822Protein automated matches [256690] (1 species)
    not a true protein
  7. 2861823Species Mouse (Mus musculus) [TaxId:10090] [256691] (1 PDB entry)
  8. 2861824Domain d4ct0a1: 4ct0 A:3-205 [256692]
    Other proteins in same PDB: d4ct0a2
    automated match to d4k0ra1
    complexed with cl, p6g, zn

Details for d4ct0a1

PDB Entry: 4ct0 (more details), 2.45 Å

PDB Description: Crystal Structure of Mouse Cryptochrome1 in Complex with Period2
PDB Compounds: (A:) Cryptochrome-1

SCOPe Domain Sequences for d4ct0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ct0a1 c.28.1.1 (A:3-205) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnavhwfrkglrlhdnpalkeciqgadtircvyildpwfagssnvginrwrfllqcledl
danlrklnsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklateagv
evivrishtlydldkiielnggqppltykrfqtlvskmeplempadtitsdvigkcmtpl
sddhdekygvpsleelgfdtdgl

SCOPe Domain Coordinates for d4ct0a1:

Click to download the PDB-style file with coordinates for d4ct0a1.
(The format of our PDB-style files is described here.)

Timeline for d4ct0a1: