| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) ![]() automatically mapped to Pfam PF00875 |
| Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (3 proteins) |
| Protein automated matches [256690] (1 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [256691] (1 PDB entry) |
| Domain d4ct0a1: 4ct0 A:3-205 [256692] Other proteins in same PDB: d4ct0a2 automated match to d4k0ra1 complexed with cl, p6g, zn |
PDB Entry: 4ct0 (more details), 2.45 Å
SCOPe Domain Sequences for d4ct0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ct0a1 c.28.1.1 (A:3-205) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnavhwfrkglrlhdnpalkeciqgadtircvyildpwfagssnvginrwrfllqcledl
danlrklnsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklateagv
evivrishtlydldkiielnggqppltykrfqtlvskmeplempadtitsdvigkcmtpl
sddhdekygvpsleelgfdtdgl
Timeline for d4ct0a1: