Lineage for d1amoa1 (1amo A:243-518)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14602Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 14603Superfamily b.43.1: Ferredoxin reductase-like, FAD-binding (N-terminal) domain [50413] (5 families) (S)
  5. 14671Family b.43.1.5: NADPH-cytochrome p450 reductase-like [50438] (2 proteins)
  6. 14672Protein NADPH-cytochrome p450 reductase [50439] (1 species)
  7. 14673Species Rat (Rattus norvegicus) [TaxId:10116] [50440] (1 PDB entry)
  8. 14674Domain d1amoa1: 1amo A:243-518 [25669]
    Other proteins in same PDB: d1amoa2, d1amoa3, d1amob2, d1amob3

Details for d1amoa1

PDB Entry: 1amo (more details), 2.6 Å

PDB Description: three-dimensional structure of nadph-cytochrome p450 reductase: prototype for fmn-and fad-containing enzymes

SCOP Domain Sequences for d1amoa1:

Sequence, based on SEQRES records: (download)

>d1amoa1 b.43.1.5 (A:243-518) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus)}
rqyelvvhedmdvakvytgemgrlksyenqkppfdaknpflaavtanrklnqgterhlmh
leldisdskiryesgdhvavypandsalvnqigeilgadldvimslnnldeesnkkhpfp
cpttyrtaltyylditnpprtnvlyelaqyasepseqehlhkmasssgegkelylswvve
arrhilailqdypslrppidhlcellprlqaryysiassskvhpnsvhicavaveyeaks
grvnkgvatswlrakepagenggralvpmfvrksqf

Sequence, based on observed residues (ATOM records): (download)

>d1amoa1 b.43.1.5 (A:243-518) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus)}
rqyelvvhedmdvakvytgemgrlksyenqkppfdaknpflaavtanrklnqgterhlmh
leldisdskiryesgdhvavypandsalvnqigeilgadldvimslnnldeesnkkhpfp
cpttyrtaltyylditnpprtnvlyelaqyasepseqehlhkmasssgegkelylswvve
arrhilailqdypslrppidhlcellprlqaryysiassskvhpnsvhicavaveyeaks
grvnkgvatswlrakepalvpmfvrksqf

SCOP Domain Coordinates for d1amoa1:

Click to download the PDB-style file with coordinates for d1amoa1.
(The format of our PDB-style files is described here.)

Timeline for d1amoa1: