Lineage for d1amoa1 (1amo A:243-518)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2054165Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2054655Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2054656Family b.43.4.1: NADPH-cytochrome p450 reductase FAD-binding domain-like [50438] (4 protein domains)
    there is an alpha-helical subdomain inserted in this domain
    automatically mapped to Pfam PF00667
  6. 2054657Protein NADPH-cytochrome p450 reductase [50439] (1 species)
  7. 2054658Species Norway rat (Rattus norvegicus) [TaxId:10116] [50440] (4 PDB entries)
  8. 2054661Domain d1amoa1: 1amo A:243-518 [25669]
    Other proteins in same PDB: d1amoa2, d1amoa3, d1amob2, d1amob3
    complexed with fad, fmn, nap

Details for d1amoa1

PDB Entry: 1amo (more details), 2.6 Å

PDB Description: three-dimensional structure of nadph-cytochrome p450 reductase: prototype for fmn-and fad-containing enzymes
PDB Compounds: (A:) nadph-cytochrome p450 reductase

SCOPe Domain Sequences for d1amoa1:

Sequence, based on SEQRES records: (download)

>d1amoa1 b.43.4.1 (A:243-518) NADPH-cytochrome p450 reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rqyelvvhedmdvakvytgemgrlksyenqkppfdaknpflaavtanrklnqgterhlmh
leldisdskiryesgdhvavypandsalvnqigeilgadldvimslnnldeesnkkhpfp
cpttyrtaltyylditnpprtnvlyelaqyasepseqehlhkmasssgegkelylswvve
arrhilailqdypslrppidhlcellprlqaryysiassskvhpnsvhicavaveyeaks
grvnkgvatswlrakepagenggralvpmfvrksqf

Sequence, based on observed residues (ATOM records): (download)

>d1amoa1 b.43.4.1 (A:243-518) NADPH-cytochrome p450 reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rqyelvvhedmdvakvytgemgrlksyenqkppfdaknpflaavtanrklnqgterhlmh
leldisdskiryesgdhvavypandsalvnqigeilgadldvimslnnldeesnkkhpfp
cpttyrtaltyylditnpprtnvlyelaqyasepseqehlhkmasssgegkelylswvve
arrhilailqdypslrppidhlcellprlqaryysiassskvhpnsvhicavaveyeaks
grvnkgvatswlrakepalvpmfvrksqf

SCOPe Domain Coordinates for d1amoa1:

Click to download the PDB-style file with coordinates for d1amoa1.
(The format of our PDB-style files is described here.)

Timeline for d1amoa1: