Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (28 species) not a true protein |
Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [256684] (1 PDB entry) |
Domain d4cs5b2: 4cs5 B:127-254 [256686] automated match to d1plqa2 |
PDB Entry: 4cs5 (more details), 3 Å
SCOPe Domain Sequences for d4cs5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cs5b2 d.131.1.0 (B:127-254) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]} gipetdyacviklpsgefaricrdlsqfgesiviactkegvkfsaagdigtaniklaqts svdkeeeavviemqepvtltfacrylnmftkatplspqvslsmspdvplvveyaigeigh iryflapk
Timeline for d4cs5b2:
View in 3D Domains from other chains: (mouse over for more information) d4cs5a1, d4cs5a2, d4cs5c1, d4cs5c2 |