SCOPe 2.05: Domain d4cr0a_: 4cr0 A:

Lineage for d4cr0a_ (4cr0 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (24 species)
   not a true protein

7. Species Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [228150] (10 PDB entries)

8. Domain d4cr0a_: 4cr0 A: [256682]
   Other proteins in same PDB: d4cr0b_
   automated match to d1rd8a_
   complexed with nag; mutant

Details for d4cr0a_

PDB Entry: 4cr0, 2.65 Å

PDB Description: crystal structure of h5 (vn1194) asn186lys/gly143arg mutant haemagglutinin

PDB Compounds: (A:) haemagglutinin ha1

SCOPe Domain Sequences for d4cr0a_:

Sequence; same for both SEQRES and ATOM records:

>d4cr0a_ b.19.1.2 (A:) automated matches {Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqrkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pkdaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

Timeline for d4cr0a_:

• d4cr0a_ first appeared in SCOPe 2.04
  
• d4cr0a_ appears in SCOPe 2.06
  
• d4cr0a_ appears in the current release, SCOPe 2.08