Lineage for d4cr0b_ (4cr0 B:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709416Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1709744Protein automated matches [254646] (27 species)
    not a true protein
  7. 1709780Species Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [256672] (2 PDB entries)
  8. 1709782Domain d4cr0b_: 4cr0 B: [256681]
    Other proteins in same PDB: d4cr0a_
    automated match to d2fk0b1
    complexed with nag; mutant

Details for d4cr0b_

PDB Entry: 4cr0 (more details), 2.65 Å

PDB Description: crystal structure of h5 (vn1194) asn186lys/gly143arg mutant haemagglutinin
PDB Compounds: (B:) haemagglutinin ha2

SCOPe Domain Sequences for d4cr0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cr0b_ h.3.1.1 (B:) automated matches {Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydys

SCOPe Domain Coordinates for d4cr0b_:

Click to download the PDB-style file with coordinates for d4cr0b_.
(The format of our PDB-style files is described here.)

Timeline for d4cr0b_: