| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein Influenza hemagglutinin (stalk) [58066] (22 species) trimer |
| Species Influenza A virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [419797] (7 PDB entries) |
| Domain d4cr0b_: 4cr0 B: [256681] Other proteins in same PDB: d4cr0a_ automated match to d2fk0b1 complexed with nag; mutant |
PDB Entry: 4cr0 (more details), 2.65 Å
SCOPe Domain Sequences for d4cr0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cr0b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydys
Timeline for d4cr0b_: