Lineage for d4cqsa_ (4cqs A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531228Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1531574Protein automated matches [190291] (23 species)
    not a true protein
  7. 1531614Species Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [228150] (5 PDB entries)
  8. 1531615Domain d4cqsa_: 4cqs A: [256674]
    automated match to d1rd8a_
    complexed with mpo, nag; mutant

Details for d4cqsa_

PDB Entry: 4cqs (more details), 2.55 Å

PDB Description: h5 (vn1194) asn186lys mutant haemagglutinin in complex with avian receptor analogue 3'sln
PDB Compounds: (A:) haemagglutinin ha1

SCOPe Domain Sequences for d4cqsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cqsa_ b.19.1.2 (A:) automated matches {Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pkdaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d4cqsa_:

Click to download the PDB-style file with coordinates for d4cqsa_.
(The format of our PDB-style files is described here.)

Timeline for d4cqsa_: