Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (33 species) not a true protein |
Species Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [256672] (9 PDB entries) |
Domain d4cqpb_: 4cqp B: [256673] Other proteins in same PDB: d4cqpa_ automated match to d2fk0b1 complexed with mpo, nag; mutant |
PDB Entry: 4cqp (more details), 2.65 Å
SCOPe Domain Sequences for d4cqpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cqpb_ h.3.1.1 (B:) automated matches {Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqy
Timeline for d4cqpb_: