Lineage for d4cqpa_ (4cqp A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040710Protein automated matches [190291] (25 species)
    not a true protein
  7. 2040775Species Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [228150] (9 PDB entries)
  8. 2040780Domain d4cqpa_: 4cqp A: [256671]
    Other proteins in same PDB: d4cqpb_
    automated match to d1rd8a_
    complexed with mpo, nag; mutant

Details for d4cqpa_

PDB Entry: 4cqp (more details), 2.65 Å

PDB Description: Crystal Structure of H5 (VN1194) Ser227Asn/Gln196Arg Mutant Haemagglutinin
PDB Compounds: (A:) haemagglutinin ha1

SCOPe Domain Sequences for d4cqpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cqpa_ b.19.1.2 (A:) automated matches {Influenza a virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyrnpttyisvgtstlnqrlvpriatrskvngqngrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d4cqpa_:

Click to download the PDB-style file with coordinates for d4cqpa_.
(The format of our PDB-style files is described here.)

Timeline for d4cqpa_: