SCOP 1.73: Domain d1ep2b1: 1ep2 B:2-102

Lineage for d1ep2b1 (1ep2 B:2-102)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Dihydroorotate dehydrogenase B, PyrK subunit [50433] (1 species)

7. Species Lactococcus lactis, isozyme B [TaxId:1358] [50434] (3 PDB entries)

8. Domain d1ep2b1: 1ep2 B:2-102 [25666]
   Other proteins in same PDB: d1ep2a_, d1ep2b2
   complexed with fad, fes, fmn, oro

Details for d1ep2b1

PDB Entry: 1ep2, 2.4 Å

PDB Description: crystal structure of lactococcus lactis dihydroorotate dehydrogenase b complexed with orotate

PDB Compounds: (B:) dihydroorotate dehydrogenase b (pyrk subunit)

SCOP Domain Sequences for d1ep2b1:

Sequence; same for both SEQRES and ATOM records:

>d1ep2b1 b.43.4.2 (B:2-102) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]}
sqlqemmtvvsqrevaynifemvlkgtlvdemdlpgqflhlavpngamllrrpisisswd
kraktctilyrigdettgtyklsklesgakvdvmgplgngf

Timeline for d1ep2b1:

• d1ep2b1 first appeared (with stable ids) in SCOP 1.55
  
• d1ep2b1 appears in SCOP 1.71
  
• d1ep2b1 appears in SCOP 1.75
  
• d1ep2b1 appears in the current release, SCOPe 2.08