SCOPe 2.05: Domain d4cqjc1: 4cqj C:8-192

Lineage for d4cqjc1 (4cqj C:8-192)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold

4. Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families)

5. Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (2 proteins)

6. Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species)

7. Species Streptomyces cattleya [TaxId:29303] [102525] (11 PDB entries)

8. Domain d4cqjc1: 4cqj C:8-192 [256655]
   Other proteins in same PDB: d4cqja2, d4cqjb2, d4cqjc2
   automated match to d1rqpa2
   complexed with efa

Details for d4cqjc1

PDB Entry: 4cqj, 2.44 Å

PDB Description: Fluorinase substrate flexibility enables last step aqueous and ambient 18F fluorination of a RGD peptide for positron emission tomography

PDB Compounds: (C:) 5'-fluoro-5'-deoxy-adenosine synthase

SCOPe Domain Sequences for d4cqjc1:

Sequence; same for both SEQRES and ATOM records:

>d4cqjc1 c.132.1.1 (C:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
vrfnr

Timeline for d4cqjc1:

• d4cqjc1 first appeared in SCOPe 2.04
  
• d4cqjc1 appears in SCOPe 2.06
  
• d4cqjc1 appears in the current release, SCOPe 2.08