| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold |
Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families) ![]() |
| Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (2 proteins) |
| Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species) |
| Species Streptomyces cattleya [TaxId:29303] [102525] (12 PDB entries) |
| Domain d4cqjb1: 4cqj B:8-192 [256653] Other proteins in same PDB: d4cqja2, d4cqjb2, d4cqjc2 automated match to d1rqpa2 complexed with efa |
PDB Entry: 4cqj (more details), 2.44 Å
SCOPe Domain Sequences for d4cqjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cqjb1 c.132.1.1 (B:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
vrfnr
Timeline for d4cqjb1:
View in 3DDomains from other chains: (mouse over for more information) d4cqja1, d4cqja2, d4cqjc1, d4cqjc2 |