Class b: All beta proteins [48724] (177 folds) |
Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily) barrel, closed; n=7, S=10; greek-key topology; one overside connection |
Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families) |
Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein) |
Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species) |
Species Streptomyces cattleya [TaxId:29303] [101855] (12 PDB entries) |
Domain d4cqja2: 4cqj A:193-298 [256652] Other proteins in same PDB: d4cqja1, d4cqjb1, d4cqjc1 automated match to d1rqpa1 complexed with efa |
PDB Entry: 4cqj (more details), 2.44 Å
SCOPe Domain Sequences for d4cqja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cqja2 b.141.1.1 (A:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]} paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea
Timeline for d4cqja2:
View in 3D Domains from other chains: (mouse over for more information) d4cqjb1, d4cqjb2, d4cqjc1, d4cqjc2 |