Lineage for d4cq8a1 (4cq8 A:158-567)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080389Protein automated matches [190228] (18 species)
    not a true protein
  7. 2080446Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [256645] (7 PDB entries)
  8. 2080447Domain d4cq8a1: 4cq8 A:158-567 [256646]
    Other proteins in same PDB: d4cq8a2, d4cq8b2
    automated match to d1tv5a1
    complexed with fmn, jbw, oro

Details for d4cq8a1

PDB Entry: 4cq8 (more details), 1.98 Å

PDB Description: Plasmodium falciparum dihydroorotate dehydrogenase (DHODH) in complex with Genz-669178
PDB Compounds: (A:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d4cq8a1:

Sequence, based on SEQRES records: (download)

>d4cq8a1 c.1.4.1 (A:158-567) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
fesynpefflydiflkfclkyidgeichdlflllgkynilpydtsndsiyactnikhldf
inpfgvaagfdkngvcidsilklgfsfieigtitprgqtgnakprifrdvesrsiinscg
fnnmgcdkvtenlilfrkrqeedkllskhivgvsigknkdtvnivddlkycinkigryad
yiainvsspntpglrdnqeagklkniilsvkeeidnleknnimndeflwfnttkkkplvf
vklapdlnqeqkkeiadvlletnidgmiisntttqindiksfenkkggvsgaklkdistk
ficemynytnkqipiiasggifsgldalekieagasvcqlysclvfngmksavqikreln
hllyqrgyynlkeaigrkhs

Sequence, based on observed residues (ATOM records): (download)

>d4cq8a1 c.1.4.1 (A:158-567) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
fesynpefflydiflkfclkyidgeichdlflllgkynilpydtsndsiyactnikhldf
inpfgvaagfdkngvcidsilklgfsfieigtitprgqtgnakprifrdvesrsiinscg
fnnmgcdkvtenlilfrkrqeedkllskhivgvsigknkdtvnivddlkycinkigryad
yiainvsspntpglrdnqeagklkniilsvkeeidnleknnflwfnttkkkplvfvklap
dlnqeqkkeiadvlletnidgmiisntttqindiksfenkkggvsgaklkdistkficem
ynytnkqipiiasggifsgldalekieagasvcqlysclvfngmksavqikrelnhllyq
rgyynlkeaigrkhs

SCOPe Domain Coordinates for d4cq8a1:

Click to download the PDB-style file with coordinates for d4cq8a1.
(The format of our PDB-style files is described here.)

Timeline for d4cq8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cq8a2