SCOPe 2.05: Domain d4cnid_: 4cni D:

Lineage for d4cnid_ (4cni D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein Interleukin-6 [47272] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47273] (8 PDB entries)

8. Domain d4cnid_: 4cni D: [256634]
   Other proteins in same PDB: d4cnib1, d4cnib2, d4cnil1, d4cnil2
   automated match to d4ni9a_
   complexed with so4, tam

Details for d4cnid_

PDB Entry: 4cni, 2.2 Å

PDB Description: crystal structure of the fab portion of olokizumab in complex with il- 6

PDB Compounds: (D:) interleukin-6

SCOPe Domain Sequences for d4cnid_:

Sequence; same for both SEQRES and ATOM records:

>d4cnid_ a.26.1.1 (D:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]}
phrqpltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgc
fqsgfneetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknl
daittpdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

Timeline for d4cnid_:

• d4cnid_ first appeared in SCOPe 2.04
  
• d4cnid_ appears in SCOPe 2.06
  
• d4cnid_ appears in the current release, SCOPe 2.08