![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) ![]() |
![]() | Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
![]() | Protein Phthalate dioxygenase reductase [50430] (1 species) contains additional 2Fe-2S ferredoxin domain |
![]() | Species Pseudomonas cepacia, db01 [TaxId:292] [50431] (1 PDB entry) |
![]() | Domain d2piaa1: 2pia A:1-103 [25663] Other proteins in same PDB: d2piaa2, d2piaa3 complexed with fes, fmn |
PDB Entry: 2pia (more details), 2 Å
SCOPe Domain Sequences for d2piaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2piaa1 b.43.4.2 (A:1-103) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} ttpqedgflrlkiaskekiardiwsfeltdpqgaplppfeaganltvavpngsrrtyslc ndsqernryviavkrdsngrggsisfiddtsegdavevslprn
Timeline for d2piaa1: