SCOP 1.57: Domain d2pia_1: 2pia 1-103

Lineage for d2pia_1 (2pia 1-103)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (7 proteins)

6. Protein Phthalate dioxygenase reductase [50430] (1 species)

7. Species Pseudomonas cepacia, db01 [TaxId:292] [50431] (1 PDB entry)

8. Domain d2pia_1: 2pia 1-103 [25663]
   Other proteins in same PDB: d2pia_2, d2pia_3

Details for d2pia_1

PDB Entry: 2pia, 2 Å

PDB Description: phthalate dioxygenase reductase: a modular structure for electron transfer from pyridine nucleotides to [2fe-2s]

SCOP Domain Sequences for d2pia_1:

Sequence; same for both SEQRES and ATOM records:

>d2pia_1 b.43.4.2 (1-103) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01}
ttpqedgflrlkiaskekiardiwsfeltdpqgaplppfeaganltvavpngsrrtyslc
ndsqernryviavkrdsngrggsisfiddtsegdavevslprn

Timeline for d2pia_1:

• d2pia_1 first appeared (with stable ids) in SCOP 1.55
  
• d2pia_1 appears in SCOP 1.59
  
• d2pia_1 appears in the current release, SCOPe 2.08, called d2piaa1