| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.3: Cytochromes [47175] (3 families) ![]() Heme-containing proteins |
| Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins) automatically mapped to Pfam PF01322 |
| Protein Cytochrome c' [47180] (9 species) |
| Species Alcaligenes sp. [TaxId:512] [47184] (13 PDB entries) |
| Domain d4cjoa_: 4cjo A: [256623] automated match to d1e83a_ complexed with hec |
PDB Entry: 4cjo (more details), 1.55 Å
SCOPe Domain Sequences for d4cjoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cjoa_ a.24.3.2 (A:) Cytochrome c' {Alcaligenes sp. [TaxId: 512]}
efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrkk
Timeline for d4cjoa_: