SCOPe 2.07: Domain d4cj2c1: 4cj2 C:3-63

Lineage for d4cj2c1 (4cj2 C:3-63)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.1: "Histone-like" proteins from archaea [54161] (2 proteins)

6. Protein automated matches [190114] (2 species)
   not a true protein

7. Species Sulfolobus acidocaldarius [TaxId:2285] [186837] (12 PDB entries)

8. Domain d4cj2c1: 4cj2 C:3-63 [256622]
   Other proteins in same PDB: d4cj2a_, d4cj2b_, d4cj2c2, d4cj2d2
   automated match to d2xiwb_
   complexed with gol

Details for d4cj2c1

PDB Entry: 4cj2, 1.5 Å

PDB Description: crystal structure of hewl in complex with affitin h4

PDB Compounds: (C:) affitin h4

SCOPe Domain Sequences for d4cj2c1:

Sequence; same for both SEQRES and ATOM records:

>d4cj2c1 b.34.13.1 (C:3-63) automated matches {Sulfolobus acidocaldarius [TaxId: 2285]}
kvkffwngeekevdtskivwvkragksvlfiyddngkngygdvtekdapkelldmlarae
r

Timeline for d4cj2c1:

• d4cj2c1 first appeared in SCOPe 2.04, called d4cj2c_
  
• d4cj2c1 appears in SCOPe 2.06
  
• d4cj2c1 appears in the current release, SCOPe 2.08