Lineage for d4cj2c1 (4cj2 C:3-63)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394630Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2394631Family b.34.13.1: "Histone-like" proteins from archaea [54161] (2 proteins)
  6. 2394652Protein automated matches [190114] (2 species)
    not a true protein
  7. 2394653Species Sulfolobus acidocaldarius [TaxId:2285] [186837] (12 PDB entries)
  8. 2394657Domain d4cj2c1: 4cj2 C:3-63 [256622]
    Other proteins in same PDB: d4cj2a_, d4cj2b_, d4cj2c2, d4cj2d2
    automated match to d2xiwb_
    complexed with gol

Details for d4cj2c1

PDB Entry: 4cj2 (more details), 1.5 Å

PDB Description: crystal structure of hewl in complex with affitin h4
PDB Compounds: (C:) affitin h4

SCOPe Domain Sequences for d4cj2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cj2c1 b.34.13.1 (C:3-63) automated matches {Sulfolobus acidocaldarius [TaxId: 2285]}
kvkffwngeekevdtskivwvkragksvlfiyddngkngygdvtekdapkelldmlarae
r

SCOPe Domain Coordinates for d4cj2c1:

Click to download the PDB-style file with coordinates for d4cj2c1.
(The format of our PDB-style files is described here.)

Timeline for d4cj2c1: