| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
| Family b.34.13.1: Histone-like proteins from archaea [54161] (2 proteins) |
| Protein automated matches [190114] (2 species) not a true protein |
| Species Sulfolobus acidocaldarius [TaxId:2285] [186837] (12 PDB entries) |
| Domain d4cj2c1: 4cj2 C:3-63 [256622] Other proteins in same PDB: d4cj2a_, d4cj2b_, d4cj2c2, d4cj2d2 automated match to d2xiwb_ complexed with gol |
PDB Entry: 4cj2 (more details), 1.5 Å
SCOPe Domain Sequences for d4cj2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cj2c1 b.34.13.1 (C:3-63) automated matches {Sulfolobus acidocaldarius [TaxId: 2285]}
kvkffwngeekevdtskivwvkragksvlfiyddngkngygdvtekdapkelldmlarae
r
Timeline for d4cj2c1:
View in 3DDomains from other chains: (mouse over for more information) d4cj2a_, d4cj2b_, d4cj2d1, d4cj2d2 |